BLASTP 2.16.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: pdb_seqres_proteins.fas 904,157 sequences; 265,710,038 total letters Query= sp|P0DTC7|NS7A_SARS2 ORF7a protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=7a PE=1 SV=1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 7ci3_A mol:protein length:84 Orf7a protein 185 7e-59 1yo4_A mol:protein length:87 Hypothetical protein X4 165 6e-51 1xak_A mol:protein length:83 SARS ORF7A ACCESSORY PROTEIN 165 7e-51 6w37_A mol:protein length:67 ORF7a protein 151 6e-46 >7ci3_A mol:protein length:84 Orf7a protein Length=84 Score = 185 bits (434), Expect = 7e-59, Method: Compositional matrix adjust. Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%) Query 14 TCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKH 73 TCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKH Sbjct 2 TCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKH 61 Query 74 VYQLRARSVSPKLFIRQEEVQEL 96 VYQLRARSVSPKLFIRQEEVQEL Sbjct 62 VYQLRARSVSPKLFIRQEEVQEL 84 >1yo4_A mol:protein length:87 Hypothetical protein X4 Length=87 Score = 165 bits (387), Expect = 6e-51, Method: Compositional matrix adjust. Identities = 76/84 (90%), Positives = 78/84 (93%), Gaps = 1/84 (1%) Query 16 ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVY 75 ELYHYQECVRGTTVLLKEPC SGTYEGNSPFHPLADNKFALTC ST+FAFAC DG +H Y Sbjct 3 ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY 62 Query 76 QLRARSVSPKLFIRQEEV-QELYS 98 QLRARSVSPKLFIRQEEV QELYS Sbjct 63 QLRARSVSPKLFIRQEEVQQELYS 86 >1xak_A mol:protein length:83 SARS ORF7A ACCESSORY PROTEIN Length=83 Score = 165 bits (386), Expect = 7e-51, Method: Compositional matrix adjust. Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%) Query 14 TCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKH 73 +CELYHYQECVRGTTV+LKEPC SGTYEGNSPFHPLADNKFALTC ST+FAFAC DG +H Sbjct 1 SCELYHYQECVRGTTVILKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRH 60 Query 74 VYQLRARSVSPKLFIRQEEVQE 95 YQLRARSVSPKLFIRQEEVQ+ Sbjct 61 TYQLRARSVSPKLFIRQEEVQQ 82 >6w37_A mol:protein length:67 ORF7a protein Length=67 Score = 151 bits (353), Expect = 6e-46, Method: Compositional matrix adjust. Identities = 67/67 (100%), Positives = 67/67 (100%), Gaps = 0/67 (0%) Query 16 ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVY 75 ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVY Sbjct 1 ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVY 60 Query 76 QLRARSV 82 QLRARSV Sbjct 61 QLRARSV 67 Lambda K H a alpha 0.341 0.195 0.782 0.443 1.38 Gapped Lambda K H a alpha sigma 0.290 0.0750 0.280 1.04 11.5 12.3 Effective search space used: 13166616050 Database: pdb_seqres_proteins.fas Posted date: Apr 4, 2025 8:37 PM Number of letters in database: 265,710,038 Number of sequences in database: 904,157 Matrix: BLOSUM90 Gap Penalties: Existence: 10, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40