BLASTP 2.16.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: pdb_seqres_proteins.fas 904,157 sequences; 265,710,038 total letters Query= sp|P0DTC7|NS7A_SARS2 ORF7a protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=7a PE=1 SV=1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 7ci3_A mol:protein length:84 Orf7a protein 307 1e-90 1yo4_A mol:protein length:87 Hypothetical protein X4 260 5e-73 6w37_A mol:protein length:67 ORF7a protein 248 4e-71 1xak_A mol:protein length:83 SARS ORF7A ACCESSORY PROTEIN 250 6e-70 5eov_A mol:protein length:220 16S/23S rRNA (cytidine-2'-O)-methyl... 34.3 1.3 5kyg_A mol:protein length:225 Cytotoxin / haemolysin homologue TlyA 34.3 1.3 5ks2_A mol:protein length:225 16S/23S rRNA (cytidine-2'-O)-methyl... 34.3 1.3 7s0s_B mol:protein length:284 16S/23S rRNA (Cytidine-2'-O)-methyl... 34.3 1.3 6g79_S mol:protein length:364 5-hydroxytryptamine receptor 1B 31.4 9.6 5v54_B mol:protein length:395 5-hydroxytryptamine receptor 1B,OB-... 31.4 9.7 5v54_A mol:protein length:395 5-hydroxytryptamine receptor 1B,OB-... 31.4 9.7 7c61_A mol:protein length:399 5-hydroxytryptamine receptor 1B,Sol... 31.4 9.7 4iar_A mol:protein length:401 Chimera protein of human 5-hydroxyt... 31.4 9.7 4iaq_A mol:protein length:403 Chimera protein of human 5-hydroxyt... 31.4 9.7 >7ci3_A mol:protein length:84 Orf7a protein Length=84 Score = 307 bits (747), Expect = 1e-90 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%) Query 14 TCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKH 73 TCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKH Sbjct 2 TCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKH 61 Query 74 VYQLRARSVSPKLFIRQEEVQEL 96 VYQLRARSVSPKLFIRQEEVQEL Sbjct 62 VYQLRARSVSPKLFIRQEEVQEL 84 >1yo4_A mol:protein length:87 Hypothetical protein X4 Length=87 Score = 260 bits (632), Expect = 5e-73 Identities = 76/84 (90%), Positives = 76/84 (90%), Gaps = 1/84 (1%) Query 16 ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVY 75 ELYHYQECVRGTTVLLKEPC SGTYEGNSPFHPLADNKFALTC ST FAFAC DG H Y Sbjct 3 ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY 62 Query 76 QLRARSVSPKLFIRQEEV-QELYS 98 QLRARSVSPKLFIRQEEV QELYS Sbjct 63 QLRARSVSPKLFIRQEEVQQELYS 86 >6w37_A mol:protein length:67 ORF7a protein Length=67 Score = 248 bits (603), Expect = 4e-71 Identities = 67/67 (100%), Positives = 67/67 (100%), Gaps = 0/67 (0%) Query 16 ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVY 75 ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVY Sbjct 1 ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVY 60 Query 76 QLRARSV 82 QLRARSV Sbjct 61 QLRARSV 67 >1xak_A mol:protein length:83 SARS ORF7A ACCESSORY PROTEIN Length=83 Score = 250 bits (608), Expect = 6e-70 Identities = 72/80 (90%), Positives = 72/80 (90%), Gaps = 0/80 (0%) Query 15 CELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHV 74 CELYHYQECVRGTTV LKEPC SGTYEGNSPFHPLADNKFALTC ST FAFAC DG H Sbjct 2 CELYHYQECVRGTTVILKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHT 61 Query 75 YQLRARSVSPKLFIRQEEVQ 94 YQLRARSVSPKLFIRQEEVQ Sbjct 62 YQLRARSVSPKLFIRQEEVQ 81 >5eov_A mol:protein length:220 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA Length=220 Score = 34.3 bits (79), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%), Gaps = 0/15 (0%) Query 68 PDGVKHVYQLRARSV 82 P GV H QLRARSV Sbjct 146 PGGVVHDPQLRARSV 160 >5kyg_A mol:protein length:225 Cytotoxin / haemolysin homologue TlyA Length=225 Score = 34.3 bits (79), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%), Gaps = 0/15 (0%) Query 68 PDGVKHVYQLRARSV 82 P GV H QLRARSV Sbjct 151 PGGVVHDPQLRARSV 165 >5ks2_A mol:protein length:225 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA Length=225 Score = 34.3 bits (79), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%), Gaps = 0/15 (0%) Query 68 PDGVKHVYQLRARSV 82 P GV H QLRARSV Sbjct 151 PGGVVHDPQLRARSV 165 >7s0s_B mol:protein length:284 16S/23S rRNA (Cytidine-2'-O)-methyltransferase TlyA Length=284 Score = 34.3 bits (79), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%), Gaps = 0/15 (0%) Query 68 PDGVKHVYQLRARSV 82 P GV H QLRARSV Sbjct 210 PGGVVHDPQLRARSV 224 >6g79_S mol:protein length:364 5-hydroxytryptamine receptor 1B Length=364 Score = 31.4 bits (72), Expect = 9.6 Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%) Query 7 LALITLAT 14 LALITLAT Sbjct 24 LALITLAT 31 >5v54_B mol:protein length:395 5-hydroxytryptamine receptor 1B,OB-1 fused 5-HT1b receptor,5-hydroxytryptamine receptor 1B Length=395 Score = 31.4 bits (72), Expect = 9.7 Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%) Query 7 LALITLAT 14 LALITLAT Sbjct 20 LALITLAT 27 >5v54_A mol:protein length:395 5-hydroxytryptamine receptor 1B,OB-1 fused 5-HT1b receptor,5-hydroxytryptamine receptor 1B Length=395 Score = 31.4 bits (72), Expect = 9.7 Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%) Query 7 LALITLAT 14 LALITLAT Sbjct 20 LALITLAT 27 >7c61_A mol:protein length:399 5-hydroxytryptamine receptor 1B,Soluble cytochrome b562,5-hydroxytryptamine receptor 1B Length=399 Score = 31.4 bits (72), Expect = 9.7 Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%) Query 7 LALITLAT 14 LALITLAT Sbjct 25 LALITLAT 32 >4iar_A mol:protein length:401 Chimera protein of human 5-hydroxytryptamine receptor 1B and E. Coli soluble cytochrome b562 Length=401 Score = 31.4 bits (72), Expect = 9.7 Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%) Query 7 LALITLAT 14 LALITLAT Sbjct 27 LALITLAT 34 >4iaq_A mol:protein length:403 Chimera protein of human 5-hydroxytryptamine receptor 1B and E. Coli soluble cytochrome b562 Length=403 Score = 31.4 bits (72), Expect = 9.7 Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%) Query 7 LALITLAT 14 LALITLAT Sbjct 27 LALITLAT 34 Lambda K H a alpha 0.289 0.282 1.70 0.170 0.168 Gapped Lambda K H a alpha sigma 0.283 0.255 1.49 0.190 0.246 0.227 Effective search space used: 27076546880 Database: pdb_seqres_proteins.fas Posted date: Apr 4, 2025 8:37 PM Number of letters in database: 265,710,038 Number of sequences in database: 904,157 Matrix: IDENTITY Gap Penalties: Existence: 15, Extension: 2 Neighboring words threshold: 27 Window for multiple hits: 40